PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr10P19650_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family GRAS
Protein Properties Length: 478aa    MW: 51052.7 Da    PI: 5.6264
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr10P19650_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS50.24.7e-16148204157
                    GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsv 57 
                             lv++Ll+cAeav++++l++a+al++++s la+++g +m+++a yf+eALa+r++r +
  GSMUA_Achr10P19650_001 148 LVHALLACAEAVQQDNLKAADALVKQISVLATSQGGAMRKVAGYFAEALARRIYRPQ 204
                             689**************************************************9955 PP

2GRAS201.84e-62209386105275
                    GRAS 105 avegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlel 191
                             a++g++rvH++Df++ qG+QWpaLlqaLa Rp+gpps+R+Tg+g+p+++++++l+e+g++La++Ae+++v+f+++ +va +l+dle+
  GSMUA_Achr10P19650_001 209 AFAGCRRVHVVDFGMRQGMQWPALLQALALRPGGPPSFRLTGIGPPQPDNSDALQEVGWKLAQLAESIRVDFRYRGFVAASLADLEP 295
                             799************************************************************************************ PP

                    GRAS 192 eeL...........rvkp..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyys 265
                              +L           +      E++aVn+v++lhrll+++++l++    vL +v+ ++P++v+vveqea+hn+++F erf+eal+yys
  GSMUA_Achr10P19650_001 296 YMLldqdadgggggK--DeePEVVAVNSVFELHRLLARPGALDK----VLGTVRAVRPRIVTVVEQEANHNGGTFQERFTEALHYYS 376
                             **9766555555433..1569***************99999999....*************************************** PP

                    GRAS 266 alfdsleakl 275
                             ++fdsle ++
  GSMUA_Achr10P19650_001 377 TMFDSLEGGA 386
                             ******9875 PP

3GRAS965.8e-30387463299374
                    GRAS 299 acegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                             a++gaer+erhetl++Wr r+++aGF+pvp++++a kqa++ll+ ++ +dgyrvee++g+l+lgW++rpL+++SaWr
  GSMUA_Achr10P19650_001 387 AAAGAERTERHETLAQWRGRMDRAGFEPVPIGSNAFKQASMLLALFAgGDGYRVEEKDGCLTLGWHTRPLIATSAWR 463
                             5789************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF120416.8E-2941100IPR021914Transcriptional factor DELLA, N-terminal
SMARTSM011293.3E-2441124No hitNo description
PROSITE profilePS5098531.74675442IPR005202Transcription factor GRAS
PfamPF035141.6E-13148204IPR005202Transcription factor GRAS
PfamPF035141.4E-59209386IPR005202Transcription factor GRAS
PfamPF035142.0E-27387463IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 478 aa     Download sequence    Send to blast
MKRGHQDTLH GGGGWYAVEP EMERGKRKTT MRAAEEGGEV DELLAALGYK VRSSDMADVA  60
HKLEQLEMAM VSSAATNDDA LLSHLASDTV HYNPSDLSTW PLPALPAPAD SLVLGSPPSS  120
STTTDAATSA AAALPVVVVD SQEAGIRLVH ALLACAEAVQ QDNLKAADAL VKQISVLATS  180
QGGAMRKVAG YFAEALARRI YRPQPRGGAF AGCRRVHVVD FGMRQGMQWP ALLQALALRP  240
GGPPSFRLTG IGPPQPDNSD ALQEVGWKLA QLAESIRVDF RYRGFVAASL ADLEPYMLLD  300
QDADGGGGGK DEEPEVVAVN SVFELHRLLA RPGALDKVLG TVRAVRPRIV TVVEQEANHN  360
GGTFQERFTE ALHYYSTMFD SLEGGAAAAG AERTERHETL AQWRGRMDRA GFEPVPIGSN  420
AFKQASMLLA LFAGGDGYRV EEKDGCLTLG WHTRPLIATS AWRVAAPAED PLSASAAR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-361484634375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ1530422e-42DQ153042.1 Musa AAB Group GRAS transcription factor (GAI1) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009380281.10.0PREDICTED: DELLA protein SLN1-like
SwissprotQ9ST480.0DWRF8_MAIZE; DELLA protein DWARF8
TrEMBLM0RJP00.0M0RJP0_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr10P19650_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP99838138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.11e-152RGA-like 1